PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.2901s0005.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 266aa    MW: 29428 Da    PI: 6.7485
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.2901s0005.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like971.4e-3080133155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          +prl+Wtp+LH+rFv+av++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Araha.2901s0005.1.p  80 RPRLVWTPQLHKRFVDAVAHL-GIKNAVPKTIMQLMSVDGLTRENVASHLQKYRL 133
                          59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.05977136IPR017930Myb domain
SuperFamilySSF466892.24E-2077137IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.3E-3179138IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-2481133IPR006447Myb domain, plants
PfamPF002499.4E-883132IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MREEDSNWFA KWEEELPSPE ELIPLSQALI TPDLAIAFDL HRDNSNSGQP LPQTTPPQPN  60
SSTEFAGDSP GDEPARTLKR PRLVWTPQLH KRFVDAVAHL GIKNAVPKTI MQLMSVDGLT  120
RENVASHLQK YRLYLKRMQS GGGGGGGGDS DHLFASSPVP PHFLHPTSRQ SSDLFIPSFV  180
PISTQQQHIA APPSQFLHRQ ISAVNFTSPT KATDQAMFLA RQQSQLQQPV FRPSSLHLHS  240
QVANYTQDLD SEAKTVLTLF PTRDD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-2079138463ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00056PBMTransfer from AT5G05090Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0052450.0AB005245.2 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MUG13.
GenBankAY0931880.0AY093188.1 Arabidopsis thaliana unknown protein (At5g05090) mRNA, complete cds.
GenBankBT0062890.0BT006289.1 Arabidopsis thaliana At5g05090 mRNA, complete cds.
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002871136.11e-163myb family transcription factor
SwissprotQ9SNB41e-46PCL1_ARATH; Transcription factor LUX
TrEMBLD7LYA41e-163D7LYA4_ARALL; Myb family transcription factor
STRINGscaffold_600469.11e-162(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15492791
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G05090.11e-150G2-like family protein